PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00007.1.g09520.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 311aa    MW: 34213.9 Da    PI: 10.7119
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00007.1.g09520.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.23.7e-281969252
                       G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52
                                  prlrWt+eLH+ Fv+av+ LGG++kAtPk il+lm+v gLt++hvkSHLQ+
  Zjn_sc00007.1.g09520.1.sm.mk 19 PRLRWTTELHHGFVRAVDCLGGPDKATPKLILQLMDVRGLTIAHVKSHLQR 69
                                  8*************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-261569IPR009057Homeodomain-like
PROSITE profilePS5129410.5851575IPR017930Myb domain
SuperFamilySSF466898.78E-141771IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-201969IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGGGRNGAAT RRYNRSKVPR LRWTTELHHG FVRAVDCLGG PDKATPKLIL QLMDVRGLTI  60
AHVKSHLQRC NHGKQQYIRS THSPLMREDA PKSSCAHPRK GFSFPLPLSF LTFQHWSIES  120
KRSPSSLGCM FLPPWMNRAK AGAEAAAATH ESMLQRNTDM GAPGTQRCSD DCMQAVSMGR  180
SRRWTDQGIG WQRHAAASST LQALGFWVRG YAPFKISRPI VNHISPVARQ VSSKYISLED  240
RRFMFSIRDE PAERRSPSQS LDPEAVDAIT SWHSVSSVVG VPSPLPSSTS FSGCSGPSGG  300
CFAGQKEALN I
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955145.18e-82PREDICTED: uncharacterized protein LOC101762085
TrEMBLK3YZB74e-81K3YZB7_SETIT; Uncharacterized protein
STRINGSi019625m1e-80(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.18e-26G2-like family protein